PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g009060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 648aa    MW: 71280.5 Da    PI: 6.4564
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g009060.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.41e-122391956
                    HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 19 FeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    F+++++p+ ++r++L ++lgL   q+k+WFqN+R++ k
  Csa16g009060.1  2 FKECPHPDDKQRRDLGRQLGLAPVQIKFWFQNKRTQNK 39
                    9**********************************998 PP

2START1754.7e-551673872206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     la  a++el+++a+++ep+W+  +      +n de+ ++f ++ +     +++ea+r++++v m+++ +ve l++ +  W++++     +a t+e
  Csa16g009060.1 167 LAIGAMEELLLMAQVGEPLWMGGVdgtsLALNLDEYARTFRKGLGprlsgFRIEASRETALVAMNPTGVVEMLMQAN-LWSTMFVgmvgRAITHE 260
                     67889****************9998877789*********88776********************************.***************** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                     ++ ++      galq m+ae+q+lsplv+ R+++fvRy++q+g+  w++vdvS+d+  +++     ++++++pSg+li++ +ng+skvtwvehv+
  Csa16g009060.1 261 KLLTDvaenfnGALQIMSAEYQVLSPLVStRESYFVRYCKQQGENLWAVVDVSIDHLLPNTH----MKCRRRPSGCLIQEIPNGYSKVTWVEHVE 351
                     ************************************************************96....999************************** PP

                     --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++r   +++++++++sg+a++a++wvatl+rqce+
  Csa16g009060.1 352 VNDREAnQNIFKHFISSGQAFAANRWVATLERQCER 387
                     ****999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.53E-11148IPR009057Homeodomain-like
CDDcd000862.43E-11142No hitNo description
PROSITE profilePS5007113.669141IPR001356Homeobox domain
SMARTSM003890.0033145IPR001356Homeobox domain
PfamPF000462.9E-10139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-11246IPR009057Homeodomain-like
PROSITE profilePS5084838.325157390IPR002913START domain
SuperFamilySSF559612.09E-31158389No hitNo description
CDDcd088753.19E-112162386No hitNo description
SMARTSM002344.7E-43166387IPR002913START domain
PfamPF018523.7E-46167387IPR002913START domain
Gene3DG3DSA:3.30.530.204.6E-7223355IPR023393START-like domain
SuperFamilySSF559611.59E-14409607No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
FFKECPHPDD KQRRDLGRQL GLAPVQIKFW FQNKRTQNKN HQERCENTEL RSLNSKLRSE  60
NERFREAVFL ALCPKCGGKT AIGEMSFEEH HLRIVNARLN EEINELTALA VKFSSKSVIS  120
YPVMSPRPSN RPPTFEFGAG SSSESGGNFS RGITGTADAD TPMVMELAIG AMEELLLMAQ  180
VGEPLWMGGV DGTSLALNLD EYARTFRKGL GPRLSGFRIE ASRETALVAM NPTGVVEMLM  240
QANLWSTMFV GMVGRAITHE KLLTDVAENF NGALQIMSAE YQVLSPLVST RESYFVRYCK  300
QQGENLWAVV DVSIDHLLPN THMKCRRRPS GCLIQEIPNG YSKVTWVEHV EVNDREANQN  360
IFKHFISSGQ AFAANRWVAT LERQCERIAS IMTTDFQSVD SPDHLVLTEH GKTSILKLAE  420
RVARSFFVGL TSSMGTTFSG VGGDDIRMMT MKNINDPGRP PGVVFSAATS FWVPAPPKIV  480
FDFLRDVDHR ASWDVLCAGG VVHKISEIAN GRDSRNCATL LRNEIPFEKK MMIIQETSTD  540
PTASFVIYAP VDTESIEGVL SAGQDPDYVA LLPSGFAILP DGMGDQPGGN GGGGSLLTVS  600
FQMLVEGVDL GKLSITSVAT VENLIRTTVL RIKALFPFQI ATPSLGK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010469602.10.0PREDICTED: homeobox-leucine zipper protein HDG3-like
RefseqXP_010469603.10.0PREDICTED: homeobox-leucine zipper protein HDG3-like
RefseqXP_010469604.10.0PREDICTED: homeobox-leucine zipper protein HDG3-like
SwissprotQ9ZV650.0HDG3_ARATH; Homeobox-leucine zipper protein HDG3
TrEMBLR0HIB70.0R0HIB7_9BRAS; Uncharacterized protein
STRINGAT2G32370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32370.10.0homeodomain GLABROUS 3